PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast03G050200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 405aa    MW: 44446.8 Da    PI: 9.6032
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast03G050200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM149.22.1e-46511812128
                 NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                         +pGfrFhPt+eel+ +yL++kv+gk++++ + i+ +d+y+++PwdLp  ++ ++kew+f+++rd+ky++g+r+nr+t  gyWkatg d+ v
  Brast03G050200.1.p  51 MPGFRFHPTEEELIEFYLRRKVDGKRFNI-DLISFLDLYRYDPWDLPGLASIGDKEWFFYVPRDRKYRNGDRPNRVTPLGYWKATGADRMV 140
                         79***************************.99***************877889************************************** PP

                 NAM  93 lsk.....kgelvglkktLvfykgrapkgektdWvmheyrl 128
                          +       ++ +glkktLvfy g+apkg++++W+m+eyrl
  Brast03G050200.1.p 141 RVVageagVSRSIGLKKTLVFYVGKAPKGVRSSWIMNEYRL 181
                         998555444445***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.28E-5349201IPR003441NAC domain
PROSITE profilePS5100553.89550201IPR003441NAC domain
PfamPF023652.0E-2352181IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 405 aa     Download sequence    Send to blast
MTRSRAAPAP GTTTMAAGAG GSSPEEQQQQ QHGDHQAIED HQDEPQQETV MPGFRFHPTE  60
EELIEFYLRR KVDGKRFNID LISFLDLYRY DPWDLPGLAS IGDKEWFFYV PRDRKYRNGD  120
RPNRVTPLGY WKATGADRMV RVVAGEAGVS RSIGLKKTLV FYVGKAPKGV RSSWIMNEYR  180
LPHADAQRYQ KEISLCRVYK RPGIEDNFHL TGTTTRSSAS SKATGTKHHT GAAHRTTATT  240
NRQQHAPMFV SGHHPSPSSL KPYNHQAAAA AGVQMAPPPA MFLRSTASVA SLSSTTSTEE  300
DGTSLYHLKG PNNSNPAAMQ PSSMHASSLL NMSSSAAAMA AIPIDELSRA IGSYSTQAAA  360
NPNNNQQQPT PPSQISPLLN FPSLEKIWDW NPLLESPKVC TSFK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B3e-51332011165NAC domain-containing protein 19
4dul_A3e-51332011165NAC domain-containing protein 19
1ut7_B3e-51332011165NO APICAL MERISTEM PROTEIN
1ut7_A3e-51332011165NO APICAL MERISTEM PROTEIN
1ut4_B3e-51332011165NO APICAL MERISTEM PROTEIN
1ut4_A3e-51332011165NO APICAL MERISTEM PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003571314.20.0PREDICTED: transcription factor JUNGBRUNNEN 1-like
TrEMBLI1I0G60.0I1I0G6_BRADI; Uncharacterized protein
TrEMBLA0A0Q3HN850.0A0A0Q3HN85_BRADI; Uncharacterized protein
STRINGBRADI3G13630.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP77063650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.21e-90NAC domain containing protein 35